PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_182350_utkc.t1
Common NameSOVF_182350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family BES1
Protein Properties Length: 350aa    MW: 38309.9 Da    PI: 9.3638
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_182350_utkc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822204.23.9e-63511821133
             DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspes 92 
                        ++++rkp+w+ErEnn+rRERrRRaiaaki++GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++p+  +e++ s+++ s +s
  Sp_182350_utkc.t1  51 AAARRKPSWRERENNRRRERRRRAIAAKIFSGLRAQGNYNLPKHCDNNEVLKALCSEAGWIVEPDGTTYRKGMRPP-PPEIVASFNHFSACS 141
                        5899************************************************************************.*************** PP

             DUF822  93 slqsslkssalaspvesysaspksssfpspssldsislasa 133
                        s+  s+ ssa++sp++sy++sp+ss+ +sp++ + +  +++
  Sp_182350_utkc.t1 142 SQVPSPLSSAFQSPIHSYQPSPSSSAPQSPTRNEINAQSHP 182
                        *99*****************************877755433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-5953176IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
ERESCTPPTQ QKQRIPRGGA LSVEVAAAFT VTKTRGEREM ATEGGGGGAA AAARRKPSWR  60
ERENNRRRER RRRAIAAKIF SGLRAQGNYN LPKHCDNNEV LKALCSEAGW IVEPDGTTYR  120
KGMRPPPPEI VASFNHFSAC SSQVPSPLSS AFQSPIHSYQ PSPSSSAPQS PTRNEINAQS  180
HPFSFLCNSI PSSLPPLRIS NSAPVTPLLS SPTSKTAPKQ PVFNFEAIAN ESMASFNYPM  240
FAASAPSSPS RRRNFTPPTI PECDESDCST IDSGQWISFQ RFSRPPIPNS PTFNLVRPMV  300
QKMSLNDAIQ DRARVAEAES MQVTPWEGER IHDVGMDDLE LTLGSGTARN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15372RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010684125.11e-174PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-109BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0K9QG860.0A0A0K9QG86_SPIOL; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000398791e-115(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-83BES1 family protein